PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P14760_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 254aa    MW: 28978.9 Da    PI: 9.76
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P14760_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.8e-29958150
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                           krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+l+ey+
  GSMUA_Achr6P14760_001  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLFEYA 58
                           79***********************************************8 PP

2K-box100.52.3e-33821739100
                  K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                            + + +a+++qqe+akL+++i+ +q+++R l+Ge+L+s+sl++++qLe++Lek+++kiR+kKnell ++ie++qk+e elq++n  Lr+
  GSMUA_Achr6P14760_001  82 VPQLNAQHYQQESAKLQQQINHIQSTNRSLMGEGLSSMSLRDMKQLENKLEKGISKIRTKKNELLNAEIEYMQKREMELQNDNVFLRN 169
                            778899********************************************************************************** PP

                  K-box  97 klee 100
                            k+ e
  GSMUA_Achr6P14760_001 170 KITE 173
                            *976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.221161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-32274IPR002100Transcription factor, MADS-box
CDDcd002654.20E-44275No hitNo description
PRINTSPR004045.6E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2586171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.08487177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALVVFSS RGRLFEYANN  60
SVKATIERYK KACSDTAGTG SVPQLNAQHY QQESAKLQQQ INHIQSTNRS LMGEGLSSMS  120
LRDMKQLENK LEKGISKIRT KKNELLNAEI EYMQKREMEL QNDNVFLRNK ITENERAQQQ  180
MNSLPSASEY EILTPFDSRN FLQVLQPAQH YSQHQQAGLQ LGYGQIVMNT NGTLNLVYSD  240
SSSANQLLLR SFCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-20169169Myocyte-specific enhancer factor 2B
1tqe_R1e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-20169169Myocyte-specific enhancer factor 2B
1tqe_P1e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009404530.11e-164PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ408721e-113AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLM0T7240.0M0T724_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P14760_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-96MIKC_MADS family protein